PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g15246.1.p
Common NameBRADI_5g15246, LOC100837963
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 279aa    MW: 30725.2 Da    PI: 7.5731
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g15246.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171966148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT +Ed+ll++ v+q+G g+W+++++  g++R++k+c++rw +yl
  Bradi5g15246.1.p 19 KGPWTGQEDKLLLEHVRQHGDGRWNSVSKLTGLKRSGKSCRLRWVNYL 66
                      79********************************************97 PP

2Myb_DNA-binding53.65e-1772116147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T++E+  +v++++ +G++ W+tIar ++ gRt++++k++w+++
  Bradi5g15246.1.p  72 RGKMTPQEESTIVQLHAVWGNR-WSTIARSLP-GRTDNEIKNYWRTH 116
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7481466IPR017930Myb domain
SuperFamilySSF466896.25E-2917113IPR009057Homeodomain-like
SMARTSM007172.1E-151868IPR001005SANT/Myb domain
PfamPF002491.6E-161966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-222073IPR009057Homeodomain-like
CDDcd001671.05E-112166No hitNo description
PROSITE profilePS5129424.82667121IPR017930Myb domain
SMARTSM007172.5E-1571119IPR001005SANT/Myb domain
PfamPF002491.2E-1472116IPR001005SANT/Myb domain
CDDcd001672.07E-1074117No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2374119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MADGQVTGSW GVQDDGWRKG PWTGQEDKLL LEHVRQHGDG RWNSVSKLTG LKRSGKSCRL  60
RWVNYLRPDL KRGKMTPQEE STIVQLHAVW GNRWSTIARS LPGRTDNEIK NYWRTHFKKG  120
KPSKNIERAR ARFLKQRREM QQQQQQQEQQ QQQSLLLAGQ DKADAAELAG ARTASIVVED  180
EQSAGGMGVA TSTLAGAGHD HREELIMQDV MDFLCPMSCV LQLQHGGGQG GAAGSSCCAS  240
TSEGYGSSED DGPATWGSLW NLEDVVVHDV GGGAWTLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261911927126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-124AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581410.10.0PREDICTED: myb-related protein 340
TrEMBLA0A0Q3KTE70.0A0A0Q3KTE7_BRADI; Uncharacterized protein
STRINGSi010822m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-65myb domain protein 79